PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G251700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 182aa    MW: 21017.8 Da    PI: 9.1184
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G251700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-181469156
                       TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                       +r++ +++++ql+ Le+ F  ++++  e++ +LA +lgL+ +qV +W+qN+Ra++k
  Aqcoe1G251700.1.p 14 KRHKNRLSEDQLRLLEASFSHEKKLEPERKFQLAYELGLPPKQVAIWYQNKRARWK 69
                       688999*************************************************9 PP

2HD-ZIP_I/II106.42.2e-3416107293
        HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                        +k rls++q++lLE sF++e+kLeperK +la eLgl p+qva+W+qn+RAR+kt+++E dy+a++ ++d++ +++ rL+kev +Lr el++
  Aqcoe1G251700.1.p  16 HKNRLSEDQLRLLEASFSHEKKLEPERKFQLAYELGLPPKQVAIWYQNKRARWKTQNIELDYRAIQLRLDSVLADRGRLQKEVMRLRMELQR 107
                        799************************************************************************************99985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.861171IPR001356Homeobox domain
SuperFamilySSF466893.34E-181278IPR009057Homeodomain-like
SMARTSM003891.5E-161375IPR001356Homeobox domain
CDDcd000864.47E-131472No hitNo description
PfamPF000461.6E-151469IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.3E-181576IPR009057Homeodomain-like
PRINTSPR000319.8E-54251IPR000047Helix-turn-helix motif
PROSITE patternPS0002704669IPR017970Homeobox, conserved site
PRINTSPR000319.8E-55167IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MKFPKSHNQK NTPKRHKNRL SEDQLRLLEA SFSHEKKLEP ERKFQLAYEL GLPPKQVAIW  60
YQNKRARWKT QNIELDYRAI QLRLDSVLAD RGRLQKEVMR LRMELQRSQE VLFSLNLNQP  120
PLPSLNTSCE EDGSSSLPSD ANCPWENSEA LQVEQVYAFL MGSGDQTSML NNNSLFNPSN  180
S*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010245574.12e-67PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLA5C5U43e-57A5C5U4_VITVI; Putative uncharacterized protein
STRINGVIT_10s0003g00380.t019e-57(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.12e-27homeobox protein 52